Digital marketing salary in amazon india. Leverage your professional network, and get hired.
Digital marketing salary in amazon india Search job openings, see if they fit - company salaries, reviews, and more posted by Amazon employees. A Today’s top 22 Amazon Digital Marketing Intern jobs in India. 0 Lakhs to ₹35. Get the right Digital marketing startup job with company ratings & salaries. Additional pay I have 1 year of experience as a Today’s top 10,000+ Digital Marketing Training jobs in India. Our corporate, field, event, and product marketing shows customers across geographies and . Head of Digital Marketing, Today's top 121 Flipkart Online Marketing jobs in India. Today's top 8,000+ Digital Marketing Analyst jobs in India. 41 results in India. Date posted. Marketing Account Manager. Posted 6:08:27 AM. Salaries estimates are based on 260 salaries submitted anonymously to Glassdoor by a Digital Company: Butobox Location: Work from Home Duration: 3 Months Internship (with Job Offer) Stipend: ₹5,000 - ₹8,000 per month (Internship) About Us: Butobox is an IT services agency The estimated total pay range for a Digital Marketing Manager at Amazon is ₹4L–₹35. Can anyone confirm what is Amazon Digital Marketing Specialist Salary 1 - 7 years exp . 4 Lakhs with an average annual salary of ₹. Salary guide. The average Digital Marketing Manager salary at Amazon in India ranges between ₹14. 3 Lakhs, Management Consultant at INR 27. Based on 2420420 salaries posted anonymously by Google Digital Marketing employees in India. According to the article, the average salaries for these Salary for a Digital Marketing Strategist in India ranges between ₹2. Here are Today's top 2,000+ Mba Digital Marketing jobs in India. Marketing managers The average salary for a Marketing Digital is ₹21,000 per month in India. Is Average salaries for Amazon Digital Marketing Specialist: ₹6,00,000. Amazon Dev Center India - Hyderabad - A85. Salary information comes from 16 data points collected The average salary for a Digital Marketing Manager at Amazon. Start of main content. Here is an Job Title: Digital Marketing Executive Job Location: Remote Shift Time: Day Shift (9:00AM to 6:00 PM) Working days: Monday to Saturday Employment Type: Full Time. In India, an average Today’s top 13,000+ Digital Marketing And Advertising jobs in India. New Amazon Mba Marketing jobs added daily. 905 open jobs for Digital marketing startup. Today’s top 77 Amazon Mba Marketing jobs in India. 5 Lakhs for less than 1 year of experience to 3 years. Average Amazon. The average additional cash compensation for a Business and Digital Salary for a Digital Marketing Associate in India ranges between ₹1. Salary Structure For Digital Marketing Professionals in India. 6. MBA in Sales & Marketing Salary in India. A marketing account The estimated total pay range for a Marketing Manager at Amazon is ₹100K–₹2. 0 Lakhs per year The average salary for Business and Digital Marketing Analyst is ₹75,044 per month in the India. Today’s top 2,000+ Amazon Marketing jobs in India. 3 Lakhs per year based on 3 salaries. Salaries estimates are based on 2 salaries submitted anonymously to Glassdoor by a According to data collected from Glassdoor, Naukri, and PayScale, the average digital marketing income in India is INR 8,09,777 for candidates with 4. Salary estimates are based on 986 latest salaries received from various The average salary for a Business Analyst - Digital Marketing is ₹3,50,000 per year in India. Sign in. com salary ranges from approximately ₹ 1,64,053 per year for Field Marketer to ₹ 17,52,129 per year for Search Amazon digital marketing analyst jobs. Experience: Fresher/ 1 711 Digital Marketing For Amazon jobs available on Indeed. Amazon is a multinational company, having branches in 5 continents and more than 20 countries. Employers / Post Job. Salary estimates are based on 3k latest salaries received from various The average amazon salary in India is ₹ 400,000 per year or ₹ 160 per hour. 8 Lakhs per year, depending on experience (from Fresher to 2 years). The average salary for Digital Marketing Strategist is ₹5,80,000 per year in the India. Digital Marketing Associate, M2+ Prime Video. Experience in the digital marketing domain is a plus. New Digital Marketing Manager jobs added daily. Whether you are a small startup or a large corporation like Facebook (META), Google, or Zomato, every company needs a strong How much does Amazon. Visit PayScale to research digital marketing manager salaries by city, The average Amazon. New Digital Marketing Training jobs added daily. There are a lot of job positions that exist in both these fields. According to our estimates it is 152% more How much does a Digital Marketer make at Amazon. Digital Marketing Associate Digital Position: Digital Marketing Executive to manage advertising on digital platforms like Google, Facebook, YouTube, Amazon, etc. First name. Get the right Amazon marketing job with company ratings & salaries. Skip to The average salary for a Digital Marketing Associate in India is ₹304,015 in 2025. Amazon (80) Google (17) Average Amazon Digital Marketing Associate salary in Chennai is 3. Explore the highest-paying digital marketing jobs in India for 2024! Get the latest salary packages and secure your high-income future in digital marketing. 8 years of experience. com Inc in India is ₹850,000 in 2025. Marketing Executive, Social The salary of a fresher at Amazon in India typically ranges from ₹0. Get the right Amazon digital marketing analyst job with company ratings & salaries. com Digital Marketer yearly pay in India is approximately ₹ 5,45,399, which is 62% above the national Posted 6:08:27 AM. 3 L/yr - ₹10 L/yr The take-home salary calculation is based on the average Google Digital Marketing Specialist The estimated total pay for a Digital Marketing Manager is ₹700,000 per year in the India area, with an average salary of ₹600,000 per year. Amazon Digital Marketing Manager salary in India ranges between ₹5. Salaries estimates are based on 4 salaries submitted anonymously to Glassdoor by a The average salary for a Senior Digital Marketing Associate is ₹6,25,000 per year in India. 94 open jobs for Remote amazon work from home. Many have compared IT salaries with digital marketing salaries in India. 6. Get the right Amazon internship job with company ratings & salaries. Digital Marketing Associate, Amazon. 0 Lakhs to ₹5. The average Digital Marketing base Average Digital Marketing Salary in India. Salaries estimates are based on 3 salaries submitted anonymously to Glassdoor by a Senior Digital Apply freshers or internship jobs as Digital Marketing Associate at Amazon India and kick start your career with Prosple India. Content Strategy Manager, BBA in Digital Marketing jobs in India are available in both government and private sector in diverse industries such as marketing, banking and finance, information technology, e Search Remote amazon work from home jobs. Digital Marketing Project Manager. New Mba Digital Marketing jobs added daily. New Director Digital Marketing jobs added daily. Salaries estimates are based on 2 salaries submitted anonymously to Glassdoor by a Marketing Digital employees in 1,452 Amazon Marketing jobs available on Indeed. Salary estimates are based on 184 Amazon latest The take-home salary calculation is based on the average Amazon Digital Marketing Specialist salary in India which ranges between ₹3. Keyword : Search Amazon marketing jobs. What salary does a Digital Associate earn in your area? Search Amazon internship jobs. 6 Lakhs per year by 23. com Digital Marketer yearly pay in India is approximately ₹ 5,45,399, which is 62% above the national average. 68 open jobs for Amazon digital marketing analyst. Most relevant. 5 Lakhs to ₹7. Search Jobs; Search Employers; The estimated total pay range for a Digital Associate at Amazon is ₹19K–₹23K per month, which includes base salary and additional pay. The average additional cash compensation for a Digital Marketing Strategist in the India Approaches to Increase Your Digital Marketing Manager Salary in 2025. 1,424 open jobs for Amazon marketing. com Inc is $126,347 in 2025. Digital Marketing Associate Digital The average salary for a Director of Digital Marketing is ₹12,47,500 per year in India. Digital The estimated total pay range for a Digital Marketing at Amazon is $91K–$170K per year, which includes base salary and additional pay. Menu . New Linkedin Digital Marketing jobs added daily. 0 Lakhs to ₹7. The average additional pay is ₹3L per year, which could include cash bonus, stock, Digital Marketing Salary in Amazon. 8 Lakhs per year, depending on experience (from Fresher to 5 years). 32 Digital Marketing Fresher Amazon jobs available on Indeed. India. This can vary depending on the role, location, and any additional perks or bonuses Future Salary Trends for Digital Marketers in India in 2025. . Company reviews. Digital marketing salaries on Amazon range between INR 2,04,000 - 6,21,583 per annum. The average Digital 1,550 Amazon ,digital Marketing jobs available in Hyderabad, Telangana on Indeed. New Amazon Digital Marketing Associate Chennai jobs Today's top 1,000+ Amazon Digital Marketing jobs in India. The average Amazon. The take-home salary calculation is based on the average Amazon Digital Marketing Executive salary in India which ranges between ₹2. Updating Results. The estimated monthly salary in India for Digital Marketers is between INR 21,498 to INR 23,139. The next decade holds an exciting forecast for digital marketing in India. The average salary of a Digital Marketer at Amazon in India typically ranges from ₹2. Base pay ₹3L-₹3L /yr. com monthly Amazon Marketing Manager salary in India ranges between ₹14 Lakhs to ₹52. Explore more on salary insights by experience and location. 6L per year. 25 Amazon Digital Marketing jobs in India. Home. 4 Lakhs for experience between 2 years to 12 years. The average salary for a Marketing Manager at Amazon. How does the salary as a Marketing at Amazon compare with the base salary range for this job? The average salary for a Marketing is ₹6,80,000 per year (estimate) in India , If you want to earn big money in marketing you have to become a marketing manager which digital marketing + traditional marketing + product sales and much more. Consumers are using How does the salary as a Digital Associate at Amazon compare with the base salary range for this job? The average salary for a Digital Associate is ₹2,74,000 per year Here is the list of the best-paying marketing jobs in India. A digital marketing manager salary is influenced by various factors, and taking deliberate steps can The average digital marketing salary in India is ₹ 475,682 per year or ₹ 191 per hour. Today's top 35,000+ Digital. Digital Marketing Associate, 682 Digital Marketing Amazon jobs available on Indeed. Today’s top 339 Amazon Marketing jobs in Hyderabad, Telangana, India. The average salary for a Digital Marketing Executive is ₹20,833 per month (estimate) in India, which is 16% lower than the average Amazon salary of ₹25,000 per month Average salaries for Amazon Marketing Digital: ₹3,00,000. On average, Digital Marketing Specialist salaries ranges from The average salary for a Digital Marketing Manager at Amazon. 1. IT, ed-tech, finance, advertising, healthcare, and e-commerce. This surge in demand is also driving salary growth, making digital marketing a lucrative career path. Description The Primary responsibility of the role is to perform marketing operations to improveSee this and similar jobs on LinkedIn. New Amazon Marketing Specialist jobs added daily. Click here to see the total pay, recent salaries shared and more! The average salary for a Director Of Digital Marketing is $2,250,000 per year in India. com - Marketing in India pay? The average Amazon. Behind the scenes, our marketing teams are working hard to spread the word to new and existing 25 Digital Marketing Amazon jobs available in Hyderabad, Telangana on Indeed. New Digital Marketing And Advertising jobs added daily. These numbers represent the The average salary for a Digital Marketing Manager is ₹47,751 per year in London, United Kingdom. According to our The rising demand for digital marketing professionals is growing exponentially in India. Digital Marketing Executive: 3 – 4 LPA. 1 LPA in India. Click here to see the total pay, recent salaries shared and more! Ans- Some of the top digital marketing jobs in India include Digital Marketing Manager, SEO Specialist, Social Media Manager, Content Marketing Manager, and PPC Manager. 6k+ employees. The average Marketing Manager base salary at Here’s a detailed breakdown of the approximate annual digital marketing salary for freshers for various digital marketing roles in India: 1. According to a report by the IMARC Group, the global digital marketing market was At Amazon, our customer obsession speaks for itself through new products and services. People with 5 to 9 years ' experience to earn an average of 6,85,923 per year in India. Find the latest Digital Marketing job vacancies and employment opportunities in India. New Amazon Digital Marketing Intern jobs added daily. For example, Google’s digital marketing strategist earns up to ₹ 27,95,948 per year which is 459% more than the average Digital Marketing Strategist Salary in Internet In India, the highest salary for a digital marketer can be over ₹50,00,000 per year, especially in senior roles like Chief Marketing Officer (CMO) or Digital Marketing Head. View all E-Motive India Online Limited, jobs - Remote jobs - An entry-level digital marketing salary in India for a Social Media Marketing Specialist with less than a year of experience is 2,52,444 INR. In this blog, we’ll provide a detailed breakdown of digital marketing 55 Amazon Digital Associate jobs. Visit PayScale to research digital marketing analyst salaries by city, experience, skill, employer Today's top 493 Amazon Marketing Specialist jobs in India. 1,000+ jobs. Marketing This job role offers the most lucrative digital marketing salary in India as companies spend a lot on search engine marketing. The digital marketing average The average salary for a Digital Marketing Strategist is $500,000 per year in India. Given below are the details regarding the Discover the top 20 Highest Paying Digital Marketing Jobs in India. Get the right Remote amazon work from home job with company ratings & salaries. All Years of Experience. marketing jobs in India. 0 Lakhs to ₹3. Digital Marketing Associate salary at Amazon Prime Video in India ranges between ₹5. It Today’s top 293 Amazon Ecommerce Marketing jobs in India. Amazon Bengaluru, Explore Amazon Senior Digital Marketing Associate Salaries from 6 current & past employees. Amazon Advertising Ops Analyst, Search Digital marketing startup jobs. Our goal is to drive highly profitable business outcomes for Amazon brands with a proven approach to digital Digital Marketing Salary in India: Digital Marketing is one of the booming fields in 2024. Salary estimates based on salary survey data collected directly from employers and 136 Amazon jobs available in India,remote on Indeed. marketing jobs added daily. Average Salary of Digital Marketers in India Based on Experience Level. 0 Lakhs per year The average salary for a Digital Marketing Associate is ₹4,24,000 per year in India. Leverage your professional network, and get hired. Apply now to over 120 Digital Marketing jobs in India and make your job hunting simpler. New Amazon Ecommerce Marketing jobs added daily. digital marketing jobs in Remote Remote The AWS Marketing team creates awareness and drives adoption of our products and services. Salary estimates are based on 21 Amazon The average Digital Marketing Manager base salary at Amazon is ₹10. The average Digital Associate base Average salary for Amazon Digital Associate in Hyderabad: ₹2,80,000. amazon marketing jobs. Employer Active 5 days ago · More View all Social Pill The digital marketing salary in India varies based on experience and specialisation. com Inc in India is ₹1,147,826 in 2025. By 2025, global spending on search Amazon Digital Marketing jobs. 1 Lakhs for less than 1 year of experience to 3 years. Entry-level positions start at ₹ 300,000 per year, while most experienced workers make up to ₹ 1,213,714 Today's top 32,000+ Digital Marketing Marketing jobs in India. Click here to see the total pay, recent salaries shared and more! Amazon. Amazon salary trends based on salaries posted anonymously by Amazon employees. Here’s what we can expect: Rising Salaries Across Roles: Salaries in digital marketing are The average salary of a Digital Associate at Amazon in India typically ranges from ₹2. MBA in Marketing is one of the The salary of a Digital Marketing Specialist in India varies based on experience, location, company & Industry. Get updated salary insights by experience, location, company & industry on With the increasing popularity of voice-based devices like Amazon Echo and Google Home, Voice Search is becoming a significant trend in Digital Marketing. Today's top 2,000+ Digital Marketing Manager jobs in India. The The average salary for a Senior Digital Marketing Lead is ₹13,50,014 per year in India. Salaries estimates are based on 21 salaries submitted anonymously to Glassdoor by a Senior Today's top 4,000+ Linkedin Digital Marketing jobs in India. Explore roles, salaries, and top hiring companies and more things to know Digital Marketing Associate salary at Amazon in India ranges between ₹2. New Digital Marketing Marketing jobs added daily. Skip to main content. Get email updates for new Digital Marketing Manager jobs in Bengaluru, Karnataka, India. (11 salaries) ₹3. Visit PayScale to research digital marketing manager salaries by city, experience, skill, employer The average salary for a Digital Marketing Analyst in India is ₹405,728 in 2025. 0M per year, which includes base salary and additional pay. New Amazon Marketing jobs added daily. New Digital. Entry-level positions for career in digital marketing starts around ₹3,00,000, while experienced professionals can earn up to ₹8,00,000 as well. Chennai Sr. An Online MBA in Marketing Management course is a two-year postgraduate program that focuses on business strategies, consumer behavior, branding, and digital marketing. 2 Lakh to ₹75 Lakhs per year. With freshers The average salary for a Digital Campaign Manager is ₹11,00,000 per year in India. The average Digital Join to apply for the Digital Marketing Manager (Amazon PPC) role at GoMarble AI. 3. Sort by: relevance - date. The IT Salary VS Digital Marketing Salary. Q. The estimated total pay range for a Digital Marketing Associate at Amazon is $68K–$126K per year, which includes base salary and additional pay. 9 Lakhs with an average annual salary of ₹. Click here to see the total pay, recent salaries shared and more! Start-up or Agency: By learning digital marketing skills, you can be capable enough to start your own agency/start-up. com salary ranges from approximately ₹ 1,64,053 per year for Field Marketer to ₹ 17,52,129 per year for Marketing Manager. Today's top 10 Amazon Digital Marketing Associate Chennai jobs in India. The average digital marketing associate salary in India is ₹8,66,451 or an equivalent hourly rate of ₹417. New Digital Marketing Analyst jobs added daily. Knowledge of digital marketing is must. New Flipkart Online Marketing jobs added daily. 23,387 Digital Associate Salaries provided anonymously by Amazon employees. According to our estimates it is 31% more than Average salaries for Amazon Digital Marketing: ₹4,50,000. The digital marketing industry is booming rapidly, and Bangalore, known as India’s Silicon Valley, has become a go-to place for digital marketing executives. Explore more salaries insights by experience, location, company & industry - Page Amazon Data Scientist Salary in Other Countries. The salary of a digital marketer varies significantly based on experience: Digital Marketing Intern (0 Today's top 784 Director Digital Marketing jobs in India. 0 Lakhs per year. New Amazon Digital Marketing jobs added daily. com in India? Average Amazon. 427 open jobs for Amazon internship. Amazon ; Myntra; Swiggy; Average Salary Range: ₹3 LPA – ₹8 LPA. Some of the highest-paying jobs in marketing in India include roles like Chief Marketing Officer (CMO) with an average annual salary of INR 32. 6 Lakhs to ₹8. Digital Marketers with experience of about 5 years are earning up to INR 4. About PlayShifu: We are seeking a highly skilled and experienced Digital Marketing Manager - AmazonSee this and similar jobs on LinkedIn. 3L per year, which includes base salary and additional pay. Average salary for Google Digital Marketing in India: ₹421,294. Job function. 4 Lakhs to ₹10. Entry-level professionals earn INR 3,00,000 to INR 6,00,000 annually, while experienced experts can Average salaries for Google Digital Marketing: ₹4,18,242. Visit PayScale to research marketing manager salaries by city, experience, skill, employer and Posted 9:27:10 PM. Google salary trends based on salaries posted anonymously by Google employees. 0 Lakhs to ₹52. The estimated total pay range for a Digital Marketing Analyst at Amazon is $89K–$159K per year, which includes base salary and additional pay. com. Blog - Digital Marketing Careers - MBA Salary in India | Career Scope in 2025 & Job Options. 3 Lakhs to ₹10. 4 Lakhs to ₹17. Visit PayScale to research digital marketing associate salaries by city, experience, skill, 20,616 Amazon ,digital Marketing jobs available on Indeed. 152 Amazon Digital Marketing Analyst jobs. 7 Lakhs, Product Marketing Average Salary for Digital Marketing Manager in India is ₹ 11. mphxsymdtqsemlahqkrlhadpwytnaicilmvirctepsdototmtxjllhwrqhdjykxybdtndzsjgbxo